FA20A (FAM20A) Rabbit Polyclonal Antibody TA342031 from OriGene Technologies | Biocompare.com

Supplier Images

FA20A (FAM20A) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FA20A (FAM20A) Rabbit Polyclonal Antibody

OriGene Technologies' FA20A (FAM20A) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The FA20A (FAM20A) Rabbit Polyclonal Antibody was generated using FAM20A golgi associated secretory pathway pseudokinase as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-FAM20A Antibody

Product Specs
ItemFA20A (FAM20A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA342031
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
ReactivityHuman
TargetFAM20A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FAM20A antibody: synthetic peptide directed towards the N terminal of human FAM20A. Synthetic peptide located within the following region: SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF
NCBI Full Gene NameFAM20A golgi associated secretory pathway pseudokinase
NCBI Gene AliasesAIGFS, AI1G, FP2747
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!